NAME
Bio::Tools::Blast::HSP.pm - Bioperl BLAST High-Scoring Segment Pair object
SYNOPSIS
Object Creation
The construction of HSP objects is handled by Bio::Tools::Blast:: Sbjct.pm. You should not need to use this package directly. See _initialize() for a description of constructor parameters.
require Bio::Tools::Blast::HSP;
$hspObj = eval{ new Bio::Tools::Blast::HSP(-DATA =>\@hspData,
-PARENT =>$sbjct_object,
-NAME =>$hspCount,
-PROGRAM =>'TBLASTN',
);
};@hspData includes the raw BLAST report data for a specific HSP, and is prepared by Bio::Tools::Blast::Sbjct.pm.
INSTALLATION
This module is included with the central Bioperl distribution:
http://bio.perl.org/Core/Latest
ftp://bio.perl.org/pub/DISTFollow the installation instructions included in the README file.
DESCRIPTION
The Bio::Tools::Blast::HSP.pm module encapsulates data and methods for manipulating, parsing, and analyzing HSPs ("High-scoring Segment Pairs") derived from BLAST sequence analysis.
This module is a utility module used by the Bio::Tools::Blast::Sbjct.pm and is not intended for separate use. Please see documentation for Bio::Tools::Blast.pm for some basic information about using HSP objects (Links:).
Supports BLAST versions 1.x and 2.x, gapped and ungapped.
Bio::Tools::Blast::HSP.pm has the ability to extract a list of all residue indices for identical and conservative matches along both query and sbjct sequences. Since this degree of detail is not always needed, this behavior does not occur during construction of the HSP object. These data will automatically be collected as necessary as the HSP.pm object is used.
DEPENDENCIES
Bio::Tools::Blast::HSP.pm is a concrete class that inherits from Bio::Root::Object.pm and relies on Bio::Tools::Sbjct.pm as a container for HSP.pm objects. Bio::Seq.pm and Bio::UnivAln.pm are employed for creating sequence and alignment objects, respectively.
Relationship to UnivAln.pm & Seq.pm
HSP.pm can provide the query or sbjct sequence as a Bio::Seq.pm object via the seq() method. The HSP.pm object can also create a two-sequence Bio::UnivAln.pm alignment object using the the query and sbjct sequences via the get_aln() method. Creation of alignment objects is not automatic when constructing the HSP.pm object since this level of functionality is not always required and would generate a lot of extra overhead when crunching many reports.
FEEDBACK
Mailing Lists
User feedback is an integral part of the evolution of this and other Bioperl modules. Send your comments and suggestions preferably to one of the Bioperl mailing lists. Your participation is much appreciated.
bioperl-l@bioperl.org - General discussion
http://bio.perl.org/MailList.html - About the mailing listsReporting Bugs
Report bugs to the Bioperl bug tracking system to help us keep track the bugs and their resolution. Bug reports can be submitted via email or the web:
bioperl-bugs@bio.perl.org
http://bio.perl.org/bioperl-bugs/ AUTHOR
Steve Chervitz, <sac@bioperl.org>
SEE ALSO
Bio::Tools::Blast::Sbjct.pm - Blast hit object.
Bio::Tools::Blast.pm - Blast object.
Bio::Seq.pm - Biosequence object
Bio::UnivAln.pm - Biosequence alignment object.
Bio::Root::Object.pm - Proposed base class for all Bioperl objects.Links:
http://bio.perl.org/Core/POD/Tools/Blast/Sbjct.pm.html
http://bio.perl.org/Projects/modules.html - Online module documentation
http://bio.perl.org/Projects/Blast/ - Bioperl Blast Project
http://bio.perl.org/ - Bioperl Project HomepageCOPYRIGHT
Copyright (c) 1996-98 Steve Chervitz. All Rights Reserved. This module is free software; you can redistribute it and/or modify it under the same terms as Perl itself.
APPENDIX
Methods beginning with a leading underscore are considered private and are intended for internal use by this module. They are not considered part of the public interface and are described here for documentation purposes only.
_initialize
Usage : n/a; automatically called by Bio::Root::Object::new()
: Bio::Tools::Blast::HSP.pm objects are constructed
: automatically by Bio::Tools::Sbjct.pm, so there is no need
: for direct consumption.
Purpose : Initializes HSP data and calls private methods to extract
: the data for a given HSP.
: Calls superclass constructor first (Bio::Root::Object.pm).
Returns : n/a
Argument : Named parameters passed from new():
: All tags must be uppercase (does not call _rearrange()).
: -DATA => array ref containing raw data for one HSP.
: -PARENT => Sbjct.pm object ref.
: -NAME => integer (1..n).
: -PROGRAM => string ('TBLASTN', 'BLASTP', etc.).See Also : _set_data(), Bio::Root::Object::new(), Bio::Tools::Blast::Sbjct::_set_hsps()
_set_data
Usage : n/a; called automatically during object construction.
Purpose : Sets the query sequence, sbjct sequence, and the "match" data
: which consists of the symbols between the query and sbjct lines
: in the alignment.
Argument : Array (all lines from a single, complete HSP, one line per element)
Throws : Propagates any exceptions from the methods called ("See Also")See Also : _set_seq(), _set_residues(), _set_score_stats(), _set_match_stats(), _initialize()
_set_score_stats
Usage : n/a; called automatically by _set_data()
Purpose : Sets various score statistics obtained from the HSP listing.
Argument : String with any of the following formats:
: blast2: Score = 30.1 bits (66), Expect = 9.2
: blast2: Score = 158.2 bits (544), Expect(2) = e-110
: blast1: Score = 410 (144.3 bits), Expect = 1.7e-40, P = 1.7e-40
: blast1: Score = 55 (19.4 bits), Expect = 5.3, Sum P(3) = 0.99
Throws : Exception if the stats cannot be parsed, probably due to a change
: in the Blast report format.See Also : _set_data()
_set_match_stats
Usage : n/a; called automatically by _set_data()
Purpose : Sets various matching statistics obtained from the HSP listing.
Argument : blast2: Identities = 23/74 (31%), Positives = 29/74 (39%), Gaps = 17/74 (22%)
: blast2: Identities = 57/98 (58%), Positives = 74/98 (75%)
: blast1: Identities = 87/204 (42%), Positives = 126/204 (61%)
: blast1: Identities = 87/204 (42%), Positives = 126/204 (61%), Frame = -3
: WU-blast: Identities = 310/553 (56%), Positives = 310/553 (56%), Strand = Minus / Plus
Throws : Exception if the stats cannot be parsed, probably due to a change
: in the Blast report format.
Comments : The "Gaps = " data in the HSP header has a different meaning depending
: on the type of Blast: for BLASTP, this number is the total number of
: gaps in query+sbjct; for TBLASTN, it is the number of gaps in the
: query sequence only. Thus, it is safer to collect the data
: separately by examining the actual sequence strings as is done
: in _set_seq().See Also : _set_data(), _set_seq()
_set_seq_data
Usage : n/a; called automatically when sequence data is requested.
Purpose : Sets the HSP sequence data for both query and sbjct sequences.
: Includes: start, stop, length, gaps, and raw sequence.
Argument : n/a
Throws : Propagates any exception thrown by _set_match_seq()
Comments : Uses raw data stored by _set_data() during object construction.
: These data are not always needed, so it is conditionally
: executed only upon demand by methods such as gaps(), _set_residues(),
: etc. _set_seq() does the dirty work.See Also : _set_seq()
_set_seq
Usage : n/a; called automatically by _set_seq_data()
: $hsp_obj->($seq_type, @data);
Purpose : Sets sequence information for both the query and sbjct sequences.
: Directly counts the number of gaps in each sequence (if gapped Blast).
Argument : $seq_type = 'query' or 'sbjct'
: @data = all seq lines with the form:
: Query: 61 SPHNVKDRKEQNGSINNAISPTATANTSGSQQINIDSALRDRSSNVAAQPSLSDASSGSN 120
Throws : Exception if data strings cannot be parsed, probably due to a change
: in the Blast report format.
Comments : Uses first argument to determine which data members to set
: making this method sensitive data member name changes.
: Behavior is dependent on the type of BLAST analysis (TBLASTN, BLASTP, etc).
Warning : Sequence endpoints are normalized so that start < end. This affects HSPs
: for TBLASTN/X hits on the minus strand. Normalization facilitates use
: of range information by methods such as match().See Also : _set_seq_data(), matches(), range(), start(), end()
_set_residues
Usage : n/a; called automatically when residue data is requested.
Purpose : Sets the residue numbers representing the identical and
: conserved positions. These data are obtained by analyzing the
: symbols between query and sbjct lines of the alignments.
Argument : n/a
Throws : Propagates any exception thrown by _set_seq_data() and _set_match_seq().
Comments : These data are not always needed, so it is conditionally
: executed only upon demand by methods such as seq_inds().
: Behavior is dependent on the type of BLAST analysis (TBLASTN, BLASTP, etc).See Also : _set_seq_data(), _set_match_seq(), seq_inds()
_set_match_seq
Usage : n/a. Internal method.
: $hsp_obj->_set_match_seq()
Purpose : Set the 'match' sequence for the current HSP (symbols in between
: the query and sbjct lines.)
Returns : Array reference holding the match sequences lines.
Argument : n/a
Throws : Exception if the _matchList field is not set.
Comments : The match information is not always necessary. This method
: allows it to be conditionally prepared.
: Called by _set_residues>() and seq_str().See Also : _set_residues(), seq_str()
score
Usage : $hsp_obj->score()
Purpose : Get the Blast score for the HSP.
Returns : Integer
Argument : n/a
Throws : n/aSee Also : bits()
bits
Usage : $hsp_obj->bits()
Purpose : Get the Blast score in bits for the HSP.
Returns : Float
Argument : n/a
Throws : n/aSee Also : score()
n
Usage : $hsp_obj->n()
Purpose : Get the N value (num HSPs on which P/Expect is based).
: This value is not defined with NCBI Blast2 with gapping.
Returns : Integer or null string if not defined.
Argument : n/a
Throws : n/a
Comments : The 'N' value is listed in parenthesis with P/Expect value:
: e.g., P(3) = 1.2e-30 ---> (N = 3).
: Not defined in NCBI Blast2 with gaps.
: This typically is equal to the number of HSPs but not always.
: To obtain the number of HSPs, use Bio::Tools::Blast::Sbjct::num_hsps().See Also : score()
frame
Usage : $hsp_obj->frame()
Purpose : Get the reading frame number (-/+ 1, 2, 3) (TBLASTN/X only).
Returns : Integer or null string if not defined.
Argument : n/a
Throws : n/asignif()
Usage : $hsp_obj->signif()
Purpose : Get the P-value or Expect value for the HSP.
Returns : Float (0.001 or 1.3e-43)
: Returns P-value if it is defined, otherwise, Expect value.
Argument : n/a
Throws : n/a
Comments : Provided for consistency with Sbjct::signif()
: Support for returning the significance data in different
: formats (e.g., exponent only), is not provided for HSP objects.
: This is only available for the Sbjct or Blast object.See Also : p(), expect(), Bio::Tools::Blast::Sbjct::signif()
expect
Usage : $hsp_obj->expect()
Purpose : Get the Expect value for the HSP.
Returns : Float (0.001 or 1.3e-43)
Argument : n/a
Throws : n/a
Comments : Support for returning the expectation data in different
: formats (e.g., exponent only), is not provided for HSP objects.
: This is only available for the Sbjct or Blast object.See Also : p()
p
Usage : $hsp_obj->p()
Purpose : Get the P-value for the HSP.
Returns : Float (0.001 or 1.3e-43) or undef if not defined.
Argument : n/a
Throws : n/a
Comments : P-value is not defined with NCBI Blast2 reports.
: Support for returning the expectation data in different
: formats (e.g., exponent only) is not provided for HSP objects.
: This is only available for the Sbjct or Blast object.See Also : expect()
length
Usage : $hsp->length( [seq_type] )
Purpose : Get the length of the aligned portion of the query or sbjct.
Example : $hsp->length('query')
Returns : integer
Argument : seq_type: 'query' | 'sbjct' | 'total' (default = 'total')
Throws : n/a
Comments : 'total' length is the full length of the alignment
: as reported in the denominators in the alignment section:
: "Identical = 34/120 Positives = 67/120".
: Developer note: when using the built-in length function within
: this module, call it as CORE::length().See Also : gaps()
gaps
Usage : $hsp->gaps( [seq_type] )
Purpose : Get the number of gaps in the query, sbjct, or total alignment.
: Also can return query gaps and sbjct gaps as a two-element list
: when in array context.
Example : $total_gaps = $hsp->gaps();
: ($qgaps, $sgaps) = $hsp->gaps();
: $qgaps = $hsp->gaps('query');
Returns : scalar context: integer
: array context without args: (int, int) = ('queryGaps', 'sbjctGaps')
Argument : seq_type: 'query' | 'sbjct' | 'total'
: (default = 'total', scalar context)
: Array context can be "induced" by providing an argument of 'list' or 'array'.
Throws : n/aSee Also : length(), matches()
matches
Usage : $hsp->matches([seq_type], [start], [stop]);
Purpose : Get the total number of identical and conservative matches
: in the query or sbjct sequence for the given HSP. Optionally can
: report data within a defined interval along the seq.
: (Note: 'conservative' matches are called 'positives' in the
: Blast report.)
Example : ($id,$cons) = $hsp_object->matches('sbjct');
: ($id,$cons) = $hsp_object->matches('query',300,400);
Returns : 2-element array of integers
Argument : (1) seq_type = 'query' | 'sbjct' (default = query)
: (2) start = Starting coordinate (optional)
: (3) stop = Ending coordinate (optional)
Throws : Exception if the supplied coordinates are out of range.
Comments : Relies on seq_str('match') to get the string of alignment symbols
: between the query and sbjct lines which are used for determining
: the number of identical and conservative matches.See Also : length(), gaps(), seq_str(), Bio::Tools::Blast::Sbjct::_adjust_contigs()
frac_identical
Usage : $hsp_object->frac_identical( [seq_type] );
Purpose : Get the fraction of identical positions within the given HSP.
Example : $frac_iden = $hsp_object->frac_identical('query');
Returns : Float (2-decimal precision, e.g., 0.75).
Argument : seq_type: 'query' | 'sbjct' | 'total'
: default = 'total' (but see comments below).
Throws : n/a
Comments : Different versions of Blast report different values for the total
: length of the alignment. This is the number reported in the
: denominators in the stats section:
: "Identical = 34/120 Positives = 67/120".
: BLAST-GP uses the total length of the alignment (with gaps)
: WU-BLAST uses the length of the query sequence (without gaps).
: Therefore, when called without an argument or an argument of 'total',
: this method will report different values depending on the
: version of BLAST used.
:
: To get the fraction identical among only the aligned residues,
: ignoring the gaps, call this method with an argument of 'query'
: or 'sbjct'.See Also : frac_conserved(), num_identical(), matches()
frac_conserved
Usage : $hsp_object->frac_conserved( [seq_type] );
Purpose : Get the fraction of conserved positions within the given HSP.
: (Note: 'conservative' positions are called 'positives' in the
: Blast report.)
Example : $frac_cons = $hsp_object->frac_conserved('query');
Returns : Float (2-decimal precision, e.g., 0.75).
Argument : seq_type: 'query' | 'sbjct'
: default = 'total' (but see comments below).
Throws : n/a
Comments : Different versions of Blast report different values for the total
: length of the alignment. This is the number reported in the
: denominators in the stats section:
: "Identical = 34/120 Positives = 67/120".
: BLAST-GP uses the total length of the alignment (with gaps)
: WU-BLAST uses the length of the query sequence (without gaps).
: Therefore, when called without an argument or an argument of 'total',
: this method will report different values depending on the
: version of BLAST used.
:
: To get the fraction conserved among only the aligned residues,
: ignoring the gaps, call this method with an argument of 'query'
: or 'sbjct'.See Also : frac_conserved(), num_conserved(), matches()
num_identical
Usage : $hsp_object->num_identical();
Purpose : Get the number of identical positions within the given HSP.
Example : $num_iden = $hsp_object->num_identical();
Returns : integer
Argument : n/a
Throws : n/aSee Also : num_conserved(), frac_identical()
num_conserved
Usage : $hsp_object->num_conserved();
Purpose : Get the number of conserved positions within the given HSP.
Example : $num_iden = $hsp_object->num_conserved();
Returns : integer
Argument : n/a
Throws : n/aSee Also : num_identical(), frac_conserved()
range
Usage : $hsp->range( [seq_type] );
Purpose : Gets the (start, end) coordinates for the query or sbjct sequence
: in the HSP alignment.
Example : ($qbeg, $qend) = $hsp->range('query');
: ($sbeg, $send) = $hsp->range('sbjct');
Returns : Two-element array of integers
Argument : seq_type = string, 'query' or 'sbjct' (default = 'query')
: (case insensitive).
Throws : n/astart
Usage : $hsp->start( [seq_type] );
Purpose : Gets the start coordinate for the query, sbjct, or both sequences
: in the HSP alignment.
Example : $qbeg = $hsp->start('query');
: $sbeg = $hsp->start('sbjct');
: ($qbeg, $sbeg) = $hsp->start();
Returns : scalar context: integer
: array context without args: list of two integers
Argument : In scalar context: seq_type = 'query' or 'sbjct'
: (case insensitive). If not supplied, 'query' is used.
: Array context can be "induced" by providing an argument of 'list' or 'array'.
Throws : n/aend
Usage : $hsp->end( [seq_type] );
Purpose : Gets the end coordinate for the query, sbjct, or both sequences
: in the HSP alignment.
Example : $qbeg = $hsp->end('query');
: $sbeg = $hsp->end('sbjct');
: ($qbeg, $sbeg) = $hsp->end();
Returns : scalar context: integer
: array context without args: list of two integers
Argument : In scalar context: seq_type = 'query' or 'sbjct'
: (case insensitive). If not supplied, 'query' is used.
: Array context can be "induced" by providing an argument of 'list' or 'array'.
Throws : n/astrand
Usage : $hsp_object->strand( [seq_type] )
Purpose : Get the strand of the query or sbjct sequence.
Example : print $hsp->strand('query');
: ($qstrand, $sstrand) = $hsp->strand();
Returns : -1, 0, or 1
: -1 = Minus strand, +1 = Plus strand
: Returns 0 if strand is not defined, which occurs
: for non-TBLASTN/X reports.
: In scalar context without arguments, returns queryStrand value.
: In array context without arguments, returns a two-element list
: of strings (queryStrand, sbjctStrand).
: Array context can be "induced" by providing an argument of 'list' or 'array'.
Argument : seq_type: 'query' | 'sbjct' or undef
Throws : n/aSee Also : _set_seq(), _set_match_stats()
seq
Usage : $hsp->seq( [seq_type] );
Purpose : Get the query or sbjct sequence as a Bio::Seq.pm object.
Example : $seqObj = $hsp->seq('query');
Returns : Object reference for a Bio::Seq.pm object.
Argument : seq_type = 'query' or 'sbjct' (default = 'query').
Throws : Propagates any exception that occurs during construction
: of the Bio::Seq.pm object.
Comments : The sequence is returned in an array of strings corresponding
: to the strings in the original format of the Blast alignment.
: (i.e., same spacing).See Also : seq_str(), seq_inds(), Bio::Seq.pm
seq_str
Usage : $hsp->seq_str( seq_type );
Purpose : Get the full query, sbjct, or 'match' sequence as a string.
: The 'match' sequence is the string of symbols in between the
: query and sbjct sequences.
Example : $str = $hsp->seq_str('query');
Returns : String
Argument : seq_Type = 'query' or 'sbjct' or 'match'
Throws : Exception if the argument does not match an accepted seq_type.
Comments : Calls _set_residues() to set the 'match' sequence if it has
: not been set already.See Also : seq(), seq_inds(), _set_match_seq()
seq_inds
Usage : $hsp->seq_inds( seq_type, class, collapse );
Purpose : Get a list of residue positions (indices) for all identical
: or conserved residues in the query or sbjct sequence.
Example : @ind = $hsp->seq_inds('query', 'identical');
: @ind = $hsp->seq_inds('sbjct', 'conserved');
: @ind = $hsp->seq_inds('sbjct', 'conserved', 1);
Returns : List of integers
: May include ranges if collapse is true.
Argument : seq_type = 'query' or 'sbjct' (default = query)
: class = 'identical' or 'conserved' (default = identical)
: (can be shortened to 'id' or 'cons')
: (actually, anything not 'id' will evaluate to 'conserved').
: collapse = boolean, if true, consecutive positions are merged
: using a range notation, e.g., "1 2 3 4 5 7 9 10 11"
: collapses to "1-5 7 9-11". This is useful for
: consolidating long lists. Default = no collapse.
Throws : n/a.
Comments : Calls _set_residues() to set the 'match' sequence if it has
: not been set already.See Also : seq(), _set_residues(), collapse_nums(), Bio::Tools::Blast::Sbjct::seq_inds()
get_aln
Usage : $hsp->get_aln()
Purpose : Get a Bio::UnivAln.pm object constructed from the query + sbjct
: sequences of the present HSP object.
Example : $aln_obj = $hsp->get_aln();
Returns : Object reference for a Bio::UnivAln.pm object.
Argument : n/a.
Throws : Propagates any exception ocurring during the construction of
: the Bio::UnivAln object.
Comments : Requires Bio::UnivAln.pm.
: The Bio::UnivAln.pm object is constructed from the query + sbjct
: sequence objects obtained by calling seq().
: Gap residues are included (see $GAP_SYMBOL). It is important that
: Bio::UnivAln.pm recognizes the gaps correctly. A strategy for doing
: this is being considered. Currently it is hard-wired.See Also : seq(), Bio::UnivAln.pm
display
Usage : $sbjct_object->display( %named_parameters );
Purpose : Display information about Bio::Tools::Blast::Sbjct.pm data members
: including: length, gaps, score, significance value,
: sequences and sequence indices.
Example : $object->display(-SHOW=>'stats');
Argument : Named parameters: (TAGS CAN BE UPPER OR LOWER CASE)
: -SHOW => 'hsp',
: -WHERE => filehandle (default = STDOUT)
Returns : n/a
Status : Experimental
Comments : For more control over the display of sequence data,
: use seq(), seq_str(), seq_inds().See Also : _display_seq(), seq(), seq_str(), seq_inds(), _display_matches(), Bio::Root::Object::display()
_display_seq
Usage : n/a; called automatically by display()
Purpose : Display information about query and sbjct HSP sequences.
: Prints the start, stop coordinates and the actual sequence.
Example : n/a
Argument :
Returns : printf call.
Status : Experimental
Comments : For more control, use seq(), seq_str(), or seq_inds().See Also : display(), seq(), seq_str(), seq_inds(), _display_matches()
_display_matches
Usage : n/a; called automatically by display()
Purpose : Display information about identical and conserved positions
: within both the query and sbjct sequences.
Example : n/a
Argument :
Returns : printf call.
Status : Experimental
Comments : For more control, use seq_inds().See Also : display(), seq_inds(), _display_seq(),
homol_data
Usage : $data = $hsp_object->homo_data( %named_params );
Purpose : Gets similarity data for a single HSP.
Returns : String:
: "Homology data" for each HSP is in the format:
: "<integer> <start> <stop>"
: where integer is the value returned by homol_score().
Argument : Named params: (UPPER OR LOWERCASE TAGS)
: currently just one param is used:
: -SEQ =>'query' or 'sbjct'
Throws : n/a
Status : Experimental
Comments : This is a very experimental method used for obtaining a
: coarse indication of:
: 1) how strong the similarity is between the sequences in the HSP,
: 3) the endpoints of the alignment (sequence monomer numbers)See Also : homol_score(), Bio::Tools::Blast.::homol_data(), Bio::Tools::Blast::Sbjct::homol_data()
homol_score
Usage : $self->homol_score();
Purpose : Get a homology score (integer 1 - 3) as a coarse representation of
: the strength of the similarity independent of sequence composition.
: Based on the Blast bit score.
Example : $hscore = $hsp->homol_score();
Returns : Integer
Argument : n/a
Throws : n/a
Status : Experimental
Comments : See @Bio::Tools::Blast::HSP::SCORE_CUTOFFS for the specific values.
: Currently, BIT_SCORE HOMOL_SCORE
: --------- -----------
: >=100 --> 3
: 30-100 --> 2
: < 30 --> 1See Also : homol_data()
CLASS METHODS
collapse_nums
Usage : @cnums = collapse_nums( @numbers );
Purpose : Collapses a list of numbers into a set of ranges of consecutive terms:
: Useful for condensing long lists of consecutive numbers.
: EXPANDED:
: 1 2 3 4 5 6 10 12 13 14 15 17 18 20 21 22 24 26 30 31 32
: COLLAPSED:
: 1-6 10 12-15 17 18 20-22 24 26 30-32
Argument : List of numbers and sorted numerically.
Returns : List of numbers mixed with ranges of numbers (see above).
Throws : n/a
Comments : Probably belongs in a more general utility class.See Also : seq_inds()
FOR DEVELOPERS ONLY
Data Members
Information about the various data members of this module is provided for those wishing to modify or understand the code. Two things to bear in mind:
- 1 Do NOT rely on these in any code outside of this module.
-
All data members are prefixed with an underscore to signify that they are private. Always use accessor methods. If the accessor doesn't exist or is inadequate, create or modify an accessor (and let me know, too!).
- 2 This documentation may be incomplete and out of date.
-
It is easy for these data member descriptions to become obsolete as this module is still evolving. Always double check this info and search for members not described here.
An instance of Bio::Tools::Blast::HSP.pm is a blessed reference to a hash containing all or some of the following fields:
FIELD VALUE
--------------------------------------------------------------
(member names are mostly self-explanatory)
_score :
_bits :
_p :
_n : Integer. The 'N' value listed in parenthesis with P/Expect value:
: e.g., P(3) = 1.2e-30 ---> (N = 3).
: Not defined in NCBI Blast2 with gaps.
: To obtain the number of HSPs, use Bio::Tools::Blast::Sbjct::num_hsps().
_expect :
_queryLength :
_queryGaps :
_queryStart :
_queryStop :
_querySeq :
_sbjctLength :
_sbjctGaps :
_sbjctStart :
_sbjctStop :
_sbjctSeq :
_matchSeq : String. Contains the symbols between the query and sbjct lines
which indicate identical (letter) and conserved ('+') matches
or a mismatch (' ').
_numIdentical :
_numConserved :
_identicalRes_query :
_identicalRes_sbjct :
_conservedRes_query :
_conservedRes_sbjct :
_match_indent : The number of leading space characters on each line containing
the match symbols. _match_indent is 13 in this example:
Query: 285 QNSAPWGLARISHRERLNLGSFNKYLYDDDAG
Q +APWGLARIS G+ + Y YD+ AG
^^^^^^^^^^^^^
INHERITED DATA MEMBERS
_name : From Bio::Root::Object.pm.
:
_parent : From Bio::Root::Object.pm. This member contains a reference to the
: Bio::Tools::Blast::Sbjct.pm object to which this hit belongs.1 POD Error
The following errors were encountered while parsing the POD:
- Around line 82:
Can't have a 0 in =over 0